PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29908.m006031
Common NameRCOM_1035220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 280aa    MW: 30910.7 Da    PI: 5.2648
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29908.m006031genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.17.3e-121445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd++lvd+++++G g+W++ ++  g
    29908.m006031 14 KGPWTPEEDQKLVDYIQKHGHGSWRALPKLAG 45
                     79*************************99988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.65E-9957IPR009057Homeodomain-like
PROSITE profilePS5129411.701960IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-131246IPR009057Homeodomain-like
SMARTSM007177.0E-41364IPR001005SANT/Myb domain
PfamPF002494.3E-101448IPR001005SANT/Myb domain
CDDcd001671.33E-61646No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MARSPCCDEN GLKKGPWTPE EDQKLVDYIQ KHGHGSWRAL PKLAGSHARP HTRVIKKLIQ  60
MGFDPMTHQP RTDLFATLPH LVALLNLKDL TDNHPPLDEQ AMRLQAEAMQ LAKLQYVQFL  120
LQSATSITSN SYGQNGITDM EIFNLLNSAP TIKETPVINS SQLENPVSYP FGLASSQPLH  180
YSDVLPQLPD PQVPFSYQPS LNREMEQAAN LTTMVSQGGN NPFDSPWVLP SPTPSVPSTV  240
TETSKGNPGD ASSTTSSYGG GTSSYWPEFF FEDYVLHEVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0347262e-41KM034726.1 Jatropha curcas clone JcMYB106 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571465.11e-164PREDICTED: protein ODORANT1
TrEMBLB9RJK20.0B9RJK2_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0005s17080.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-25myb domain protein 93